PDB entry 1fnu

View 1fnu on RCSB PDB site
Description: structure of streptococcal pyrogenic exotoxin a
Deposited on 2000-08-23, released 2000-11-17
The last revision prior to the SCOP 1.59 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuA (A:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuC (C:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk