PDB entry 1fnu

View 1fnu on RCSB PDB site
Description: structure of streptococcal pyrogenic exotoxin a
Class: Toxin
Keywords: superantigen, exotoxin A
Deposited on 2000-08-23, released 2000-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnua1, d1fnua2
  • Chain 'B':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnub1, d1fnub2
  • Chain 'C':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnuc1, d1fnuc2
  • Chain 'D':
    Compound: exotoxin type a precursor (allele 1)
    Species: Streptococcus pyogenes phage T12 [TaxId:35344]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62560 (0-220)
      • conflict (152-153)
      • conflict (208-209)
    Domains in SCOPe 2.07: d1fnud1, d1fnud2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuA (A:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuC (C:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnuD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldnktsqievylttk