PDB entry 1fno

View 1fno on RCSB PDB site
Description: peptidase t (tripeptidase)
Deposited on 2000-08-22, released 2002-03-13
The last revision prior to the SCOP 1.63 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnoA (A:)
    mdkllerflhyvsldtqsksgvrqvpstegqwkllrllkqqleemglvnitlsekgtlma
    tlpanvegdipaigfishvdtspdfsgknvnpqivenyrggdialgigdevlspvmfpvl
    hqllgqtlittdgktllgaddkagvaeimtalavlkgnpiphgdikvaftpdeevgkgak
    hfdveafgaqwaytvdgggvgelefenfnaasvnikivgnnvhpgtakgvmvnalslaar
    ihaevpadeapettegyegfyhlasmkgtvdraemhyiirdfdrkqfearkrkmmeiakk
    vgkglhpdcyielviedsyynmrekvvehphildiaqqamrdchitpemkpirggtdgaq
    lsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltakrg