PDB entry 1fnl

View 1fnl on RCSB PDB site
Description:
Deposited on 2000-08-22, released 2000-11-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fnla1, d1fnla2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fnlA (A:)
    edlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaat
    vndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvt
    ylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqa