PDB entry 1fnl

View 1fnl on RCSB PDB site
Description: crystal structure of the extracellular domain of a human fcgriii
Class: immune system receptor
Keywords: beta sandwich, immunoglobulin-like, receptor, immune system receptor
Deposited on 2000-08-22, released 2000-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low affinity immunoglobulin gamma fc region receptor III-b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75015 (Start-173)
      • see remark 999 (174)
    Domains in SCOPe 2.08: d1fnla1, d1fnla2
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fnlA (A:)
rtedlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfida
atvndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhk
vtylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqa

    Sequence, based on observed residues (ATOM records): (download) 
    >1fnlA (A:)
edlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaat
vndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvt
ylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqa