PDB entry 1fng

View 1fng on RCSB PDB site
Description: histocompatibility antigen
Deposited on 2000-08-21, released 2001-03-07
The last revision prior to the SCOP 1.65 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fngA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fngA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fngB (B:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fngB (B:)
    kkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fngC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fngC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fngD (D:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fngD (D:)
    kkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew