PDB entry 1fn5

View 1fn5 on RCSB PDB site
Description: hen egg white lysozyme mutant with alanine substituted for glycine
Deposited on 2000-08-21, released 2000-09-06
The last revision prior to the SCOP 1.63 freeze date was dated 2000-09-06, with a file datestamp of 2000-09-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fn5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fn5A (A:)
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdastdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl