PDB entry 1fml

View 1fml on RCSB PDB site
Description: crystal structure of retinol dehydratase in a complex with retinol and pap
Class: transferase
Keywords: sulfotransferase, dehydratase, retinol, adenosine 3',5'-diphosphate
Deposited on 2000-08-17, released 2001-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol dehydratase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26490
      • see remark 999 (141)
    Domains in SCOPe 2.07: d1fmla_
  • Chain 'B':
    Compound: retinol dehydratase
    Species: Spodoptera frugiperda [TaxId:7108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26490
      • see remark 999 (141)
    Domains in SCOPe 2.07: d1fmlb_
  • Heterogens: CA, A3P, RTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmlA (A:)
    mekqqdlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmp
    lrptdvfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeey
    ndilpnpenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkm
    vylardprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhd
    pnmlflfyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyre
    igiladgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmlA (A:)
    lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
    fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
    penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
    prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
    fyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigilad
    gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlryp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fmlB (B:)
    mekqqdlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmp
    lrptdvfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeey
    ndilpnpenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkm
    vylardprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhd
    pnmlflfyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyre
    igiladgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmlB (B:)
    lpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdv
    fvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpn
    penldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylard
    prdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlfl
    fyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigilad
    gehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlryp