PDB entry 1fmk

View 1fmk on RCSB PDB site
Description: crystal structure of human tyrosine-protein kinase c-src
Class: phosphotransferase
Keywords: src, tyrosine kinase, phosphorylation, sh2, sh3, phosphotyrosine, proto-oncogene, phosphotransferase
Deposited on 1997-01-24, released 1997-08-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.21
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase src
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (1-451)
      • modified residue (445)
    Domains in SCOPe 2.06: d1fmka1, d1fmka2, d1fmka3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmkA (A:)
    mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdawe
    ipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhek
    lvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrfti
    ksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrk
    epeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmkA (A:)
    mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdawe
    ipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhek
    lvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarfpikwtapeaalygrftiksdvwsfgilltel
    ttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylqaf
    ledyftstepqyqpgenl