PDB entry 1fmk

View 1fmk on RCSB PDB site
Description: crystal structure of human tyrosine-protein kinase c-src
Deposited on 1997-01-24, released 1997-08-20
The last revision prior to the SCOP 1.71 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.21
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1fmk_ (-)
    mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdawe
    ipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhek
    lvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrfti
    ksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrk
    epeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmk_ (-)
    mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdawe
    ipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhek
    lvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarfpikwtapeaalygrftiksdvwsfgilltel
    ttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylqaf
    ledyftstepqyqpgenl