PDB entry 1fmj

View 1fmj on RCSB PDB site
Description: crystal structure of mercury derivative of retinol dehydratase in a complex with retinol and pap
Deposited on 2000-08-17, released 2001-05-02
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1fmja_
  • Chain 'B':
    Domains in SCOP 1.65: d1fmjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fmjA (A:)
    mekqqdlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmp
    lrptdvfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeey
    ndilpnpenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkm
    vylardprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhd
    pnmlflfyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyre
    igiladgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmjA (A:)
    pfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdvf
    vasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpnp
    enldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylardp
    rdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlflf
    yedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigiladg
    ehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fmjB (B:)
    mekqqdlpfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmp
    lrptdvfvasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeey
    ndilpnpenldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkm
    vylardprdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhd
    pnmlflfyedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyre
    igiladgehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmjB (B:)
    pfpyefrelnpeedklvkanlgafpttyvklgpkgymvyrpylkdaaniynmplrptdvf
    vasyqrsgttmtqelvwliendlnfeaaktymslryiyldgfmiydpekqeeyndilpnp
    enldmerylglleyssrpgssllaavpptekrfvkthlplslmppnmldtvkmvylardp
    rdvavssfhharllyllnkqsnfkdfwemfhrglytltpyfehvkeawakrhdpnmlflf
    yedylkdlpgciariadflgkklseeqiqrlcehlnfekfknngavnmedyreigiladg
    ehfirkgkagcwrdyfdeemtkqaekwikdnlkdtdlrypnm