PDB entry 1fmg

View 1fmg on RCSB PDB site
Description: crystal structure of porcine beta trypsin with 0.04% polydocanol
Deposited on 2000-08-17, released 2000-09-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-13, with a file datestamp of 2000-09-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fmga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fmgA (A:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
    wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
    vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan