PDB entry 1fma

View 1fma on RCSB PDB site
Description: molybdopterin synthase (moad/moae)
Class: transferase
Keywords: Isopeptide bond, transferase, Molybdenum cofactor biosynthesis
Deposited on 2000-08-16, released 2001-01-17
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.173
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: molybdopterin convertin factor, subunit 1
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fmad_
  • Chain 'E':
    Compound: molybdopterin convertin factor, subunit 2
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fmae_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fmaD (D:)
    mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
    sfdhpltdgdevaffppvtgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fmaE (E:)
    maetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmte
    kalaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylkt
    rapfwkreatpegdrwvearesdqqaakrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fmaE (E:)
    aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
    earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
    atpegdrwvearesdqqaakrw