PDB entry 1fm6

View 1fm6 on RCSB PDB site
Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.
Deposited on 2000-08-16, released 2001-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-16, with a file datestamp of 2001-02-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.25
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fm6a_
  • Chain 'D':
    Domains in SCOP 1.55: d1fm6d_
  • Chain 'U':
    Domains in SCOP 1.55: d1fm6u_
  • Chain 'X':
    Domains in SCOP 1.55: d1fm6x_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm6A (A:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm6D (D:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm6U (U:)
    nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
    phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
    kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm6X (X:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly