PDB entry 1fm4

View 1fm4 on RCSB PDB site
Description: crystal structure of the birch pollen allergen bet v 1l
Deposited on 2000-08-16, released 2002-12-20
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-20, with a file datestamp of 2002-12-20.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1fm4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm4A (A:)
    gvfnyeteatsvipaarmfkafildgdklvpkvapqaissveniegnggpgtikkinfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpvgdtlekisneikivatpdggcvlkisnky
    htkgnhevkaeqvkaskemgetllravesyllahsdayn