PDB entry 1fm0

View 1fm0 on RCSB PDB site
Description: molybdopterin synthase (moad/moae)
Class: transferase
Keywords: molybdenum cofactor biosynthesis, transferase
Deposited on 2000-08-15, released 2001-01-17
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.153
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: molybdopterin convertin factor, subunit 1
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fm0d_
  • Chain 'E':
    Compound: molybdopterin convertin factor, subunit 2
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fm0e_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fm0D (D:)
    mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
    sfdhpltdgdevaffppvtgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fm0E (E:)
    maetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmte
    kalaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylkt
    rapfwkreatpegdrwvearesdqqaakrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fm0E (E:)
    aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
    earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
    atpegdrwvearesdqqaakrw