PDB entry 1flt

View 1flt on RCSB PDB site
Description: vegf in complex with domain 2 of the flt-1 receptor
Class: complex (growth factor/transferase)
Keywords: COMPLEX (GROWTH FACTOR-TRANSFERASE), FLT-1 RECEPTOR, CYSTINE KNOT, GLYCOPROTEIN, IMMUNOGLOBULIN-LIKE DOMAIN TRANSFERASE, COMPLEX (GROWTH FACTOR-TRANSFERASE) complex
Deposited on 1997-11-20, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Compound: vascular endothelial growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fltv_
  • Chain 'W':
    Compound: vascular endothelial growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fltw_
  • Chain 'X':
    Compound: fms-like tyrosine kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fltx_
  • Chain 'Y':
    Compound: fms-like tyrosine kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1flty_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1fltV (V:)
    hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
    eesnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fltV (V:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fltW (W:)
    hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
    eesnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fltX (X:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrqt
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1fltY (Y:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fltY (Y:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq