PDB entry 1flj

View 1flj on RCSB PDB site
Description: crystal structure of s-glutathiolated carbonic anhydrase III
Class: lyase
Keywords: Carbonic Anhydrase III, Glutathione, S-Glutathiolated, S-Glutathionylated, LYASE
Deposited on 2000-08-14, released 2000-09-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase III
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1flja_
  • Heterogens: ZN, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fljA (A:)
    akewgyashngpehwhelypiakgdnqspielhtkdirhdpslqpwsvsydpgsaktiln
    ngktcrvvfddtfdrsmlrggplsgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
    hwnpkyntfgealkqpdgiavvgiflkigrekgefqilldaldkiktkgkeapfnhfdps
    clfpacrdywtyhgsfttppceecivwlllkepmtvssdqmaklrslfasaeneppvplv
    gnwrppqpikgrvvrasfk