PDB entry 1flg

View 1flg on RCSB PDB site
Description: crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa
Deposited on 2000-08-14, released 2000-08-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.142
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1flga_
  • Chain 'B':
    Domains in SCOP 1.55: d1flgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flgA (A:)
    kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
    esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
    ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
    gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
    shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
    gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
    afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
    qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
    ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
    eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1flgB (B:)
    kdvtwedianddkttgdvlqygmgthaqrwsplkqvnadnvfkltpawsysfgdekqrgq
    esqaivsdgviyvtasysrlfaldaktgkrlwtynhrlpddirpccdvvnrgaaiygdkv
    ffgtldasvvalnkntgkvvwkkkfadhgagytmtgaptivkdgktgkvllihgssgdef
    gvvgrlfardpdtgeeiwmrpfveghmgrlngkdstvtgdvkapswpddrnsptgkvesw
    shgggapwqsasfdaetntiivgagnpgpwntwartakggnphdydslytsgqvgvdpss
    gevkwfyqhtpndawdfsgnnelvlfdykakdgkivkatahadrngffyvvdrsngklqn
    afpfvdnitwashidlktgrpveregqrpplpepgqkhgkavevsppflggknwnpmays
    qdtglfyvpanhwkedywteevsytkgsaylgmgfrikrmyddhvgslramdpvsgkvvw
    ehkehlplwagvlatagnlvftgtgdgyfkafdaksgkelwkfqtgsgivsppitweqdg
    eqylgvtvgyggavplwggdmadltrpvaqggsfwvfklpsw