PDB entry 1fl3

View 1fl3 on RCSB PDB site
Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
Deposited on 2000-08-11, released 2000-11-01
The last revision prior to the SCOP 1.59 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.231
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3A (A:)
    aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
    svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsaakttpps
    vypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssvt
    vpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3B (B:)
    aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
    gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhngytceathktstspivksfn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3H (H:)
    aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
    svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsaakttpps
    vypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssvt
    vpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3L (L:)
    aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
    gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhngytceathktstspivksfn