PDB entry 1fl3

View 1fl3 on RCSB PDB site
Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2000-08-11, released 2000-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: blue fluorescent antibody (19g2)-heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1FL3 (0-207)
    Domains in SCOPe 2.07: d1fl3a1, d1fl3a2
  • Chain 'B':
    Compound: blue fluorescent antibody (19g2)-light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1FL3 (0-213)
    Domains in SCOPe 2.07: d1fl3b1, d1fl3b2
  • Chain 'H':
    Compound: blue fluorescent antibody (19g2)-heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1FL3 (0-207)
    Domains in SCOPe 2.07: d1fl3h1, d1fl3h2
  • Chain 'L':
    Compound: blue fluorescent antibody (19g2)-light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1FL3 (0-213)
    Domains in SCOPe 2.07: d1fl3l1, d1fl3l2
  • Heterogens: SPB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3A (A:)
    aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
    svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsaakttpps
    vypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssvt
    vpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3B (B:)
    aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
    gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhngytceathktstspivksfn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3H (H:)
    aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
    svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsaakttpps
    vypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsglytmsssvt
    vpsstwpstvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fl3L (L:)
    aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas
    gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhngytceathktstspivksfn