PDB entry 1fl0

View 1fl0 on RCSB PDB site
Description: crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex
Deposited on 2000-08-11, released 2000-12-06
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.221
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1fl0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fl0A (A:)
  idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
  lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
  iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgikl