PDB entry 1fkv

View 1fkv on RCSB PDB site
Description: recombinant goat alpha-lactalbumin t29i
Deposited on 2000-08-10, released 2001-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fkva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fkvA (A:)
meqltkcevfqklkdlkdyggvslpewvciafhtsgydtqaivqnndsteyglfqinnki
wckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwl
c