PDB entry 1fkt

View 1fkt on RCSB PDB site
Description: solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Class: cis-trans isomerase
Keywords: cis-trans isomerase
Deposited on 1992-03-05, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 and rapamycin-binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fkta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fktA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle