PDB entry 1fks

View 1fks on RCSB PDB site
Description: solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
Class: cis-trans isomerase
Keywords: cis-trans isomerase
Deposited on 1992-03-05, released 1994-01-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fk506 and rapamycin-binding protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
  Domains in SCOPe 2.02: d1fksa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fksA (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle