PDB entry 1fkl

View 1fkl on RCSB PDB site
Description: atomic structure of fkbp12-rapaymycin, an immunophilin-immunosuppressant complex
Deposited on 1995-08-18, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1fkl__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fkl_ (-)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfvlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiippnatlifdvellkle