PDB entry 1fkj

View 1fkj on RCSB PDB site
Description: atomic structure of fkbp12-fk506, an immunophilin immunosuppressant complex
Class: rotamase
Keywords: fk506 binding protein, fkbp12, cis-trans prolyl-isomerase
Deposited on 1995-08-18, released 1995-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 1995-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fkja_
  • Heterogens: FK5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fkjA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle