PDB entry 1fkf

View 1fkf on RCSB PDB site
Description: atomic structure of fkbp-fk506, an immunophilin-immunosuppressant complex
Deposited on 1991-05-07, released 1991-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1fkf__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fkf_ (-)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle