PDB entry 1fkb

View 1fkb on RCSB PDB site
Description: atomic structure of the rapamycin human immunophilin fkbp-12 complex
Class: isomerase
Keywords: isomerase
Deposited on 1992-07-02, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fkba_
  • Heterogens: RAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fkbA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle