PDB entry 1fje

View 1fje on RCSB PDB site
Description: solution structure of nucleolin rbd12 in complex with snre rna
Deposited on 2000-08-08, released 2001-01-03
The last revision prior to the SCOP 1.63 freeze date was dated 2001-01-03, with a file datestamp of 2001-01-03.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fjeB (B:)
gshmvegsesttpfnlfignlnpnksvaelkvaiselfakndlavvdvrtgtnrkfgyvd
fesaedlekaleltglkvfgneiklekpkgrdskkvraartllaknlsfnitedelkevf
edaleirlvsqdgkskgiayiefkseadaeknleekqgaeidgrsvslyytgekg