PDB entry 1fj8

View 1fj8 on RCSB PDB site
Description: the structure of beta-ketoacyl-[acyl carrier protein] synthase I in complex with cerulenin, implications for drug design
Class: transferase
Keywords: condensing enzymes, fatty acid elongation, cerulenin, drug design, transferase
Deposited on 2000-08-07, released 2000-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ketoacyl-[acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fj8a1, d1fj8a2
  • Chain 'B':
    Compound: beta-ketoacyl-[acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fj8b1, d1fj8b2
  • Chain 'C':
    Compound: beta-ketoacyl-[acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fj8c1, d1fj8c2
  • Chain 'D':
    Compound: beta-ketoacyl-[acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fj8d1, d1fj8d2
  • Heterogens: CER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fj8A (A:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fj8A (A:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fj8B (B:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fj8B (B:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fj8C (C:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fj8C (C:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fj8D (D:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fj8D (D:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl