PDB entry 1fj1

View 1fj1 on RCSB PDB site
Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
Deposited on 2000-08-07, released 2000-10-11
The last revision prior to the SCOP 1.63 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1A (A:)
    diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
    rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1B (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdysmywvkqapgkglkrmgwintetgepty
    addfkgrfalsldtsastaylhisnlknedtatyfcargldswgqgtsvtvssakttpps
    vyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsss
    vtvpsstwpsqtvtcsvahpassttvdkkleps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1C (C:)
    diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
    rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1D (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdysmywvkqapgkglkrmgwintetgepty
    addfkgrfalsldtsastaylhisnlknedtatyfcargldswgqgtsvtvssakttpps
    vyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsss
    vtvpsstwpsqtvtcsvahpassttvdkkleps
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1E (E:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fj1F (F:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk