PDB entry 1fip

View 1fip on RCSB PDB site
Description: the structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue
Deposited on 1994-09-26, released 1995-02-14
The last revision prior to the SCOP 1.67 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fipa_
  • Chain 'B':
    Domains in SCOP 1.67: d1fipb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fipA (A:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    alldmvmqytrgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fipA (A:)
    plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
    gtlrkklkkygmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fipB (B:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    alldmvmqytrgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fipB (B:)
    plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
    gtlrkklkkygmn