PDB entry 1fie

View 1fie on RCSB PDB site
Description: recombinant human coagulation factor xiii
Deposited on 1996-08-24, released 1997-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fieA (A:)
    ggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdk
    yennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsg
    kwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwc
    eddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmd
    lsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenp
    vrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkds
    vwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfda
    pfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqe
    eerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnryt
    itaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffv
    tarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtiqftnplketlrnvwvhld
    gpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fieA (A:)
    ggrravppnnsnaaeddlptvflnvtsvhlfkerwdtnkvdhhtdkyennklivrrgqsf
    yvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmredrsv
    rlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldnekere
    eyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpikvsrvg
    samvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqcwvfagvfn
    tflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwneawmtr
    pdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevnsdliyi
    takkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalmyga
    kkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytg
    vpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakq
    kstvltipeiiikvrgtqvvgsdmtvtiqftnplketlrnvwvhldgpgvtrpmkkmfre
    irpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fieB (B:)
    grravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdky
    ennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgk
    wgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwce
    ddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdl
    sgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpv
    rygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsv
    wnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdap
    fvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqee
    erlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnryti
    taylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvt
    arinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtiqftnplketlrnvwvhldg
    pgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fieB (B:)
    grravppnnsnaaeddlptvelqgvvpnlqeflnvtsvhlfkerwdtnkvdhhtdkyenn
    klivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwga
    kivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwcedda
    vyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgr
    gnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvryg
    qcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwny
    hcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvf
    aevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerl
    aletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnrytitay
    lsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtari
    netrdvlakqkstvltipeiiikvrgtqvvgsdmtvtiqftnplketlrnvwvhldgpgv
    trpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr