PDB entry 1fia

View 1fia on RCSB PDB site
Description:
Deposited on 1991-12-18, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fiaa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fiab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fiaA (A:)
    vltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqy
    trgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiaA (A:)
    vltvqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraal
    mmginrgtlrkklkkygmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fiaB (B:)
    vltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqy
    trgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fiaB (B:)
    vltvkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraalm
    mginrgtlrkklkkygmn