PDB entry 1fi4

View 1fi4 on RCSB PDB site
Description: the x-ray crystal structure of mevalonate 5-diphosphate decarboxylase at 2.3 angstrom resolution.
Deposited on 2000-08-03, released 2001-03-21
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-14, with a file datestamp of 2001-11-14.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.239
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fi4A (A:)
    mgsshhhhhhssglvprgshmtvytasvtapvniatlkywgkrdtklnlptnssisvtls
    qddlrtltsaatapeferdtlwlngephsidnertqnclrdlrqlrkemeskdaslptls
    qwklhivsennfptaaglassaagfaalvsaiaklyqlpqstseisriarkgsgsacrsl
    fggyvawemgkaedghdsmavqiadssdwpqmkacvlvvsdikkdvsstqgmqltvatse
    lfkeriehvvpkrfevmrkaivekdfatfaketmmdsnsfhatcldsfppifymndtskr
    iiswchtinqfygetivaytfdagpnavlyylaenesklfafiyklfgsvpgwdkkftte
    qleafnhqfessnftareldlelqkdvarviltqvgsgpqetneslidaktglpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fi4A (A:)
    vytasvtapvniatlkywgkrdtklnlptnssisvtlsqddlrtltsaatapeferdtlw
    lngephsidnertqnclrdlrqlrkemeskdaslptlsqwklhivsennfptaaglassa
    agfaalvsaiaklyqlpqstseisriarkgsgsacrslfggyvawemgkaedghdsmavq
    iadssdwpqmkacvlvvsdikkdvsstqgmqltvatselfkeriehvvpkrfevmrkaiv
    ekdfatfaketmmdsnsfhatcldsfppifymndtskriiswchtinqfygetivaytfd
    agpnavlyylaenesklfafiyklfgsvpgwdkkftteqleafnhqfessnftareldle
    lqkdvarviltqvgsgpqetneslidaktgl