PDB entry 1fi3

View 1fi3 on RCSB PDB site
Description: solution structure of the m61h mutant of pseudomonas stutzeri substrain zobell ferrocytochrome c-551
Deposited on 2000-08-03, released 2001-03-14
The last revision prior to the SCOP 1.65 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1fi3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fi3A (A:)
  qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
  hppnpvteeeakilaewvlslk