PDB entry 1fht

View 1fht on RCSB PDB site
Description: RNA-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures
Class: ribonucleoprotein
Keywords: ribonucleoprotein, rnp domain, spliceosome
Deposited on 1996-02-21, released 1996-07-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN U1A 1-117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1fhta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhtA (A:)
    avpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfverdrkrekrkpksqe