PDB entry 1fht

View 1fht on RCSB PDB site
Description: rna-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures
Deposited on 1996-02-21, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMR43
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1fht__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fht_ (-)
    avpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfverdrkrekrkpksqe