PDB entry 1fhm

View 1fhm on RCSB PDB site
Description: x-ray crystal structure of reduced rubredoxin
Class: electron transport
Keywords: reduced, Cp Rd, rubredoxin, ELECTRON TRANSPORT
Deposited on 2000-08-02, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fhma_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fhmA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhmA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve