PDB entry 1fhe

View 1fhe on RCSB PDB site
Description: glutathione transferase (fh47) from fasciola hepatica
Deposited on 1997-07-24, released 1998-07-29
The last revision prior to the SCOP 1.61 freeze date was dated 1998-07-29, with a file datestamp of 1998-07-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fhe_ (-)
    paklgywklrglaqpvrlfleylgeeyeehlygrddrekwmsekfnmgldlpnlpyyidd
    kckltqsvaimryiadkhgmlgttpeerarismiegaamdlrigfgrvcynpkfeevkee
    yvkelpktlkmwsdflgdrhyltgssvshvdfmlyetldsirylaphcldefpklkefks
    riealpkikaymeskrfikwplngwaasfgagda