PDB entry 1fha

View 1fha on RCSB PDB site
Description: solving the structure of human h ferritin by genetically engineering intermolecular crystal contacts
Class: iron storage
Keywords: iron storage
Deposited on 1990-12-20, released 1992-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • conflict (86)
    Domains in SCOP 1.73: d1fhaa_
  • Heterogens: FE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fhaA (A:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsd
    nes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fhaA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg