PDB entry 1fh6

View 1fh6 on RCSB PDB site
Description: structure of the dsdna bacteriophage hk97 mature empty capsid
Deposited on 2000-07-31, released 2000-10-04
The last revision prior to the SCOP 1.65 freeze date was dated 2000-10-04, with a file datestamp of 2000-10-04.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1fh6a_
  • Chain 'B':
    Domains in SCOP 1.65: d1fh6b_
  • Chain 'C':
    Domains in SCOP 1.65: d1fh6c_
  • Chain 'D':
    Domains in SCOP 1.65: d1fh6d_
  • Chain 'E':
    Domains in SCOP 1.65: d1fh6e_
  • Chain 'F':
    Domains in SCOP 1.65: d1fh6f_
  • Chain 'G':
    Domains in SCOP 1.65: d1fh6g_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fh6A (A:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fh6A (A:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fh6B (B:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fh6B (B:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fh6C (C:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fh6C (C:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fh6D (D:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fh6D (D:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fh6E (E:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fh6E (E:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fh6F (F:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fh6F (F:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1fh6G (G:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfssgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fh6G (G:)
    slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
    aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
    lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
    niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
    evsredrdnfvknmltilceerlalahyrptaiikgtfss