PDB entry 1fh5

View 1fh5 on RCSB PDB site
Description: crystal structure of the fab fragment of the monoclonal antibody mak33
Deposited on 2000-07-31, released 2000-09-13
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fh5H (H:)
    sggglvkpagslklscaasgftfssyymywvrqtpdkrlewvatisdggsytyypdsvkg
    rftisrdnaknnlylqmsslksedtamyycardamdywgqgtlvtvsaakttppsvypla
    vtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvtsstwpsetvtc
    nvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fh5L (L:)
    divltqspatlsvtpgesvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
    rfsgsgsgtdftlsinsvetedfgmyycqqsnswpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne