PDB entry 1fgn

View 1fgn on RCSB PDB site
Description: monoclonal murine antibody 5g9-anti-human tissue factor
Deposited on 1997-04-10, released 1998-02-25
The last revision prior to the SCOP 1.59 freeze date was dated 1998-08-19, with a file datestamp of 1998-08-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgnH (H:)
    eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
    dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgnL (L:)
    dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
    rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec