PDB entry 1fgl

View 1fgl on RCSB PDB site
Description: Cyclophilin A complexed with a fragment of HIV-1 GAG protein
Class: isomerase/viral protein
Keywords: cyclophilin, binding protein for cyclosporin a, aids, isomerase-peptide complex, isomerase-viral protein complex
Deposited on 1996-11-18, released 1997-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cyclophilin a
  Species: Homo sapiens [TaxId:9606]
  Gene: CYCLOPHILIN A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62937 (1-164)
  Domains in SCOPe 2.05: d1fgla_
• Chain 'B':
  Compound: hiv-1 gag protein
  Species: Human immunodeficiency virus type 1 [TaxId:11705]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05889
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fglA (A:)
  mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
  mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
  wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
  

  
  
• Chain 'B':
  No sequence available.