PDB entry 1fgk

View 1fgk on RCSB PDB site
Description: crystal structure of the tyrosine kinase domain of fibroblast growth factor receptor 1
Class: phosphotransferase
Keywords: transferase, tyrosine-protein kinase, ATP-binding, phosphorylation, receptor, phosphotransferase
Deposited on 1997-02-08, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fgf receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fgka_
  • Chain 'B':
    Compound: fgf receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (32)
      • engineered (32)
    Domains in SCOPe 2.07: d1fgkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fgkA (A:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgkA (A:)
    elpedprwelprdrlvlgkplgqvvlaeaiglpnrvtkvavkmlksdatekdlsdlisem
    emmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskdlvsca
    yqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttngrlpv
    kwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsn
    ctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fgkB (B:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgkB (B:)
    seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkgrlpvkwmap
    ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
    ymmmrdcwhavpsqrptfkqlvedldrivalt