PDB entry 1fgi

View 1fgi on RCSB PDB site
Description:
Deposited on 1997-03-22, released 1998-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fgia_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fgib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fgiA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
    synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
    lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
    vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgiA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskd
    lvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttn
    grlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrm
    dkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fgiB (B:)
    seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda
    tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
    leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia
    dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp
    ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fgiB (B:)
    seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkgrlpvkwmap
    ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
    ymmmrdcwhavpsqrptfkqlvedldrivalt