PDB entry 1fgc

View 1fgc on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on 2000-07-28, released 2001-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1fgcc_
  • Chain 'D':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1fgcd_
  • Heterogens: 2NC, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgcC (C:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fgcD (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf