PDB entry 1fg2

View 1fg2 on RCSB PDB site
Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class I MHC molecule h-2db
Class: immune system
Keywords: Ig Fold, IMMUNE SYSTEM
Deposited on 2000-07-27, released 2000-10-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.236
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2a1, d1fg2a2
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2b_
  • Chain 'C':
    Compound: lcmv peptidic epitope gp33
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1FG2 (0-8)
  • Chain 'D':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2d1, d1fg2d2
  • Chain 'E':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2e_
  • Chain 'F':
    Compound: lcmv peptidic epitope gp33
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1FG2 (0-8)
  • Chain 'G':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2g1, d1fg2g2
  • Chain 'H':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2h_
  • Chain 'I':
    Compound: lcmv peptidic epitope gp33
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1FG2 (0-8)
  • Chain 'J':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2j1, d1fg2j2
  • Chain 'K':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fg2k_
  • Chain 'L':
    Compound: lcmv peptidic epitope gp33
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1FG2 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fg2A (A:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2A (A:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fg2B (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2B (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fg2D (D:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2D (D:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fg2E (E:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2E (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1fg2G (G:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2G (G:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fg2H (H:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2H (H:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1fg2J (J:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2J (J:)
    phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
    retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
    dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
    tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
    qkwasvvvplgkeqnytcrvyheglpepltlrw
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1fg2K (K:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fg2K (K:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'L':
    No sequence available.